Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Human Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q9Y2R0

Expression Region

2-106

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTG LGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sptbn4 Mouse Gene Knockout Kit (CRISPR)
KN516685 1 Kit

Sptbn4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]
TA506654AM 100 µL

TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
TLR4 (Center) Rabbit Polyclonal Antibody
AP54271PU-N 400 µL

TLR4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF594 conjugate, 0.1mg/mL
BNC943175-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cyclohexyl-13C6-1,3-benzothiazol-2-amine
TRC-A621799-1MG 1 mg

N-Cyclohexyl-13C6-1,3-benzothiazol-2-amine

Sign In for Pricing
View Details
Carbonic Anhydrase II (CA2) Human Knockdown Lysate
LY300328 100 µg

Carbonic Anhydrase II (CA2) Human Knockdown Lysate

Sign In for Pricing
View Details