Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Human Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q9Y2R0

Expression Region

2-106

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTG LGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBZ Rabbit Polyclonal Antibody
TA366364 100 µL

HBZ Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Furoic Acid-d3
TRC-F863777-50MG 50 mg

2-Furoic Acid-d3

Sign In for Pricing
View Details
MCM6 (Proliferation Marker) (MCM6/3000), CF740 conjugate, 0.1mg/mL
BNC743000-100 1x 100 µL

MCM6 (Proliferation Marker) (MCM6/3000), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIF (NM_002415) Human Recombinant Protein
TP305106 20 µg

MIF (NM_002415) Human Recombinant Protein

Sign In for Pricing
View Details
SRARP Human qPCR Primer Pair (NM_178840)
HP218916 200 Reactions

SRARP Human qPCR Primer Pair (NM_178840)

Sign In for Pricing
View Details
Polystyrene A Br
HA12516001.5G 5 g

Polystyrene A Br

Sign In for Pricing
View Details