Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative uncharacterized symporter HI_1315 (HI_1315)

This Recombinant Haemophilus influenzae Putative uncharacterized symporter HI_1315 (HI_1315) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Putative uncharacterized symporter HI_1315

UniProt

P71375

Expression Region

1-105

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVDMGEQYMLTTILSFLIVTTVVAYVSWLKTKGDDLKSSKGYFLAGRGLSGLVIGCSMV LTSLSTEQLIGVNAVSYKGNFSVIAWTVPTVIPLCFLALYIIGWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL
BNC471855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL
BNC680811-100 1x 100 µL

ZAP70 (2F3.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL
BNC470741-100 1x 100 µL

Prolactin Receptor (B6.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL
BNC401857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details