Recombinant Zinnia elegans CLAVATA3/ESR (CLE) -related protein TDIF
This Recombinant Zinnia elegans CLAVATA3/ESR (CLE) -related protein TDIF spans the amino acid sequence from region 27-132.
Product Specifications
Product Name Alternative
CLAVATA3/ESR (CLE) -related protein TDIF, Tracheary element differentiation inhibitory factor, Cleaved into the following chain:, 1. TDIFp
UniProt
A1EC31
Expression Region
27-132
Origin
Zinnia elegans (Zinnia)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20��C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
KLRSTSQISHFTNPRSCSSLFFVALLIITILITMLQSSTSMEVTSLPTHQPTSSNSHDES STSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC551037-500 1x 500 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 