Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 5, mitochondrial (AIM5)

This Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 5, mitochondrial (AIM5) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 5, mitochondrial, Found in mitochondrial proteome protein 51

UniProt

D3UF10

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVP GETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF568 conjugate, 0.1mg/mL
BNC680968-100 1x 100 µL

CD63 (LAMP3/968), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details