Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69 (VPS69)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69 (VPS69) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein VPS69

UniProt

O13584

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTYIYIYTVYIQMVAFSPYRIVLPFVAFVDLASFSSFRSYQAFLRPFLRPFRHQTCSSY FALDLDFASAFVVPAASFVESLLAYQAYSAYQACLAYPACLACQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TROP-2 Antibody (001) [Biotin]
NBP2-89492B 0.1 mL

Rabbit Monoclonal TROP-2 Antibody (001) [Biotin]

Sign In for Pricing
View Details
Human Tetraspanin-1 (TSPAN1) Protein
abx600159-01 20 µg

Human Tetraspanin-1 (TSPAN1) Protein

Sign In for Pricing
View Details
Human Tetraspanin-1 (TSPAN1) Protein
abx600159-02 100 µg

Human Tetraspanin-1 (TSPAN1) Protein

Sign In for Pricing
View Details
Human Tetraspanin-1 (TSPAN1) Protein
abx600159-03 1 mg

Human Tetraspanin-1 (TSPAN1) Protein

Sign In for Pricing
View Details
Rabbit dsDNA (anti-double stranded DNA antibody IgM) ELISA KIT
EK249109 96 Well

Rabbit dsDNA (anti-double stranded DNA antibody IgM) ELISA KIT

Sign In for Pricing
View Details
SLC48A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44215151 3x 1.0 µg DNA

SLC48A1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details