Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69 (VPS69)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69 (VPS69) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein VPS69

UniProt

O13584

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHTYIYIYTVYIQMVAFSPYRIVLPFVAFVDLASFSSFRSYQAFLRPFLRPFRHQTCSSY FALDLDFASAFVVPAASFVESLLAYQAYSAYQACLAYPACLACQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA)
MBS1112645 Inquire

Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA)

Sign In for Pricing
View Details
Recombinant Human Thrombopoietin CF
288-TP-01M/CF 1 mg

Recombinant Human Thrombopoietin CF

Sign In for Pricing
View Details
STNL P022-297x74-PP-CRD/1 AC Signs
824723 Card of 1 Pictogram(s)

STNL P022-297x74-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
Glufosinate ammonium
GX1626-1g 1 g

Glufosinate ammonium

Sign In for Pricing
View Details
AFP Monoclonal Antibody
CSB-MA000233-01 50 µg

AFP Monoclonal Antibody

Sign In for Pricing
View Details
AFP Monoclonal Antibody
CSB-MA000233-02 100 µg

AFP Monoclonal Antibody

Sign In for Pricing
View Details