Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuiB (yuiB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuiB (yuiB) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuiB

UniProt

O32109

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISLPVVIISIVLFFVLFFGIGFLLNMLLRMSWIMAVIYPIVCLFIISKEKLISYVQSPG ESFASLFHRVLSLAAADVLILVSGLAGAIVSGIAINMLRKRGYQMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moxidectin EP L
TRC-M744810-5MG 5 mg

Moxidectin EP L

Sign In for Pricing
View Details
Apolipoprotein L 1 (APOL1) Rabbit Polyclonal Antibody
TA383740 100 µL

Apolipoprotein L 1 (APOL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701416 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D11]
TA500563BM 100 µL

Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D11]

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF740 conjugate, 0.1mg/mL
BNC742055-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LY75 Antibody
KC-3419-01 50 μL

LY75 Antibody

Sign In for Pricing
View Details