Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuiB (yuiB)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuiB (yuiB) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuiB

UniProt

O32109

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISLPVVIISIVLFFVLFFGIGFLLNMLLRMSWIMAVIYPIVCLFIISKEKLISYVQSPG ESFASLFHRVLSLAAADVLILVSGLAGAIVSGIAINMLRKRGYQMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYF5 Antibody
8C10359-AAT 50 µg

MYF5 Antibody

Sign In for Pricing
View Details
HOXB9 Rabbit Polyclonal Antibody
AP06674PU-N 100 µg

HOXB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EnzyFluo™ MMP-9 Inhibitor Assay Kit
EIMP9-100 100 Tests

EnzyFluo™ MMP-9 Inhibitor Assay Kit

Sign In for Pricing
View Details
Tas2r114 Mouse Gene Knockout Kit (CRISPR)
KN517199 1 Kit

Tas2r114 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NEK6 (NM_001166168) Human Recombinant Protein
TP328818M 100 µg

NEK6 (NM_001166168) Human Recombinant Protein

Sign In for Pricing
View Details
Calcium Hydroxide
TRC-C145580-5G 5 g

Calcium Hydroxide

Sign In for Pricing
View Details