Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Protein Asterix (WDR83OS)

This Recombinant Pig Protein Asterix (WDR83OS) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Protein Asterix, Protein WDR83OS homolog

UniProt

Q6Q7K0

Expression Region

1-106

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANSMSDPRSPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indole
TRC-I577320-25G 25 g

Indole

Sign In for Pricing
View Details
PMPC
TRC-P561105-1G 1 g

PMPC

Sign In for Pricing
View Details
TSR1 antibody
FNab09070 100 µg

TSR1 antibody

Sign In for Pricing
View Details
eIF3s8 (EIF3C) Human Gene Knockout Kit (CRISPR)
KN401705 1 Kit

eIF3s8 (EIF3C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GTF2IRD2B activation kit by CRISPRa
GA118058 1 Kit

Human GTF2IRD2B activation kit by CRISPRa

Sign In for Pricing
View Details
PLXNA4 Antibody
KC-7128-01 50 μL

PLXNA4 Antibody

Sign In for Pricing
View Details