Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Protein Asterix (WDR83OS)

This Recombinant Pig Protein Asterix (WDR83OS) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Protein Asterix, Protein WDR83OS homolog

UniProt

Q6Q7K0

Expression Region

1-106

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANSMSDPRSPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delta-Valerolactam-d4
TRC-V091441-5MG 5 mg

Delta-Valerolactam-d4

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), Biotin conjugate, 0.1mg/mL
BNCB0668-500 1x 500 µL

MART-1 / Melan-A (A103), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PVRIG Human Gene Knockout Kit (CRISPR)
KN210470RB 1 Kit

PVRIG Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), 0.2mg/mL
BNUB1167-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), 0.2mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]
E-AB-F1352T3-01 20 Tests

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]
E-AB-F1352T3-02 100 Tests

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details