Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein Asterix (Wdr83os)

This Recombinant Mouse Protein Asterix (Wdr83os) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Protein Asterix, Protein WDR83OS homolog

UniProt

Q6ZWX0

Expression Region

1-106

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Porcine MMP-18 ELISA Kit
GR113229 96 Well

Nori® Porcine MMP-18 ELISA Kit

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)
MBS1132068-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)
MBS1132068-02 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)
MBS1132068-03 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)
MBS1132068-04 0.1 mg (Yeast)

Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)
MBS1132068-05 0.02 mg (Baculovirus)

Recombinant Acinetobacter baumannii Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details