Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized membrane protein C19orf24 (C19orf24)

This Recombinant Human Uncharacterized membrane protein C19orf24 (C19orf24) spans the amino acid sequence from region 27-132.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C19orf24

UniProt

Q9BVV8

Expression Region

27-132

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSALTRSFYVILGFCGLTAL YFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NAIP Human Gene Knockout Kit (CRISPR)
KN416758 1 Kit

NAIP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR561440 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: SPM544]
AM50194PU-S 100 µg

CD44 Mouse Monoclonal Antibody [Clone ID: SPM544]

Sign In for Pricing
View Details
ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: 2A5]
AM26441RP-S 1 mL

ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: 2A5]

Sign In for Pricing
View Details
Human RANKL Recombinant Rabbit monoclonal Antibody
HA723861 100 µL

Human RANKL Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details