Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized membrane protein C19orf24 (C19orf24)

This Recombinant Human Uncharacterized membrane protein C19orf24 (C19orf24) spans the amino acid sequence from region 27-132.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C19orf24

UniProt

Q9BVV8

Expression Region

27-132

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSALTRSFYVILGFCGLTAL YFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORM-15341
TRC-O410010-100MG 100 mg

ORM-15341

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF740 conjugate, 0.1mg/mL
BNC740746-500 1x 500 µL

CD5 (CD5/54/F6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Caproic Acid Isopropyl Ester
TRC-C175748-500MG 500 mg

N-Caproic Acid Isopropyl Ester

Sign In for Pricing
View Details
9-cis-Retinol
TRC-R252095-5MG 5 mg

9-cis-Retinol

Sign In for Pricing
View Details
Recombinant YTHDC2 Monoclonal Antibody
E-AB-81516-01 50 µL

Recombinant YTHDC2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant YTHDC2 Monoclonal Antibody
E-AB-81516-02 100 µL

Recombinant YTHDC2 Monoclonal Antibody

Sign In for Pricing
View Details