Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suid herpesvirus 1 Envelope protein US9 homolog

This Recombinant Suid herpesvirus 1 Envelope protein US9 homolog spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Envelope protein US9 homolog, 11 kDa protein

UniProt

P11313

Expression Region

1-106

Origin

Suid herpesvirus 1 (strain Rice) (SuHV-1) (Pseudorabies virus (strain Rice) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTAAPADMDTFDPSAPVPTSVSNPAADVLLAPKGPRSPLRPQDDSDCYYSESDNETPSE FLRRVGRRQAARRRRRRCLMGVAISAAALVICSLSALIGGIIARHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/992), CF640R conjugate, 0.1mg/mL
BNC400992-100 1x 100 µL

SOX10 (SOX10/992), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF405S conjugate, 0.1mg/mL
BNC042152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL
BNC041924-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details