Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YKL044W (YKL044W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YKL044W (YKL044W) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YKL044W

UniProt

P36092

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYVIMTFSSARMSERRARIIYIWMHLSAYKINFPFVQFPTFFSLFRLQKKAAILIKNPS PFFLFFLFPYRKNSTARTIHQINQAVALVLLCVSHHLTYLPSVPSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL38 activation kit by CRISPRa
GA117474 1 Kit

Human KLHL38 activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF181 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E4]
TA811419BM 100 µL

ZNF181 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E4]

Sign In for Pricing
View Details
Benzyl 2,3:5,6-Di-O-isopropylidene-Alpha-D-mannofuranoside
TRC-B276100-5G 5 g

Benzyl 2,3:5,6-Di-O-isopropylidene-Alpha-D-mannofuranoside

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF568 conjugate, 0.1mg/mL
BNC682059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (T200/797), Biotin conjugate, 0.1mg/mL
BNCB0797-100 1x 100 µL

CD45RO (T200/797), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF85 Rabbit Polyclonal Antibody
TA372711 100 µL

ZNF85 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details