Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL032W (YFL032W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL032W (YFL032W) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YFL032W

UniProt

P43566

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVVRQSGSALSRAKKSRKYTSYRVMNVVLNTLFSFVLAPYIHYILEEISPQWTTREMNT EICFLAKFSFLLVFLFYLNFQGFNSVSNITTSSSPTYDNNRHYGND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF568 conjugate, 0.1mg/mL
BNC682978-100 1x 100 µL

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI5F4]
CF813398 100 µg

PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI5F4]

Sign In for Pricing
View Details
CD117 (Cocktail), CF740 conjugate, 0.1mg/mL
BNC741018-500 1x 500 µL

CD117 (Cocktail), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), 1mg/mL
BNUM2978-50 1x 50 µL

Cyclin B1 (G2- & M-phase Cyclin) (CCNB1/2978R), 1mg/mL

Sign In for Pricing
View Details
H3FA (HIST1H3A) pThr3 Rabbit Polyclonal Antibody
AP20891PU-N 100 µg

H3FA (HIST1H3A) pThr3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MTCO3 (COX3) Rabbit Polyclonal Antibody
TA378733 100 µL

MTCO3 (COX3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details