Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL032W (YFL032W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL032W (YFL032W) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Putative uncharacterized protein YFL032W

UniProt

P43566

Expression Region

1-106

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVVRQSGSALSRAKKSRKYTSYRVMNVVLNTLFSFVLAPYIHYILEEISPQWTTREMNT EICFLAKFSFLLVFLFYLNFQGFNSVSNITTSSSPTYDNNRHYGND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS634920 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Human MFSD11 activation kit by CRISPRa
GA112392 1 Kit

Human MFSD11 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TTC7B activation kit by CRISPRa
GA115527 1 Kit

Human TTC7B activation kit by CRISPRa

Sign In for Pricing
View Details
trans-Clopenthixol Succinate Salt
TRC-C587190-50MG 50 mg

trans-Clopenthixol Succinate Salt

Sign In for Pricing
View Details
Caspase-7 (CASP7) Mouse Monoclonal Antibody [Clone ID: MCH3-5]
AM05296PU-N 100 µg

Caspase-7 (CASP7) Mouse Monoclonal Antibody [Clone ID: MCH3-5]

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS707979 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details