Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SARS coronavirus Protein 7a (7a)

This Recombinant Human SARS coronavirus Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a, Protein U122, Protein X4

UniProt

P59635

Expression Region

16-122

Origin

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-01 0.02 mg (E-Coli)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details
Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-02 0.02 mg (Yeast)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details
Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-03 0.1 mg (E-Coli)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details
Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-04 0.1 mg (Yeast)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details
Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-05 0.02 mg (Baculovirus)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details
Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)
MBS1115344-06 0.02 mg (Mammalian-Cell)

Recombinant Rhizobium etli 3-dehydroquinate synthase (aroB)

Sign In for Pricing
View Details