Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage lambda Holin (S)

This Recombinant Enterobacteria phage lambda Holin (S) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Holin, gpS protein, Including the following 2 domains:, Lysis protein S, Lysis inhibitor

UniProt

P03705

Expression Region

1-107

Origin

Enterobacteria phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRD LLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGRNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSN Recombinant Protein (Human)
RP061368 100 µg

GSN Recombinant Protein (Human)

Sign In for Pricing
View Details
Hsa-miR-6132 inhibitor
HY-RI01877-01 5 nmol

Hsa-miR-6132 inhibitor

Sign In for Pricing
View Details
Hsa-miR-6132 inhibitor
HY-RI01877-02 20 nmol

Hsa-miR-6132 inhibitor

Sign In for Pricing
View Details
SPINT1 Blocking Peptide
33R-7084 0.1 mg

SPINT1 Blocking Peptide

Sign In for Pricing
View Details
Rno-miR-449a-5p miRNA Mimic
orb1874086-01 5 nmol

Rno-miR-449a-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-449a-5p miRNA Mimic
orb1874086-02 10 nmol

Rno-miR-449a-5p miRNA Mimic

Sign In for Pricing
View Details