Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter lari ATP synthase subunit c (atpE)

This Recombinant Campylobacter lari ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B9KD84

Expression Region

1-107

Origin

Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKIVFLMLALSGFAFAAEGSMNQWLASFSILAAGLGLGVAALGGAIGMGNTAAATIAGT ARNPGLGGKLMTTMFIALAMIEAQVIYALVIALIALYANPFQALVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-D-[2,3-13C2]neuraminic Acid
TRC-A187006-25MG 25 mg

N-Acetyl-D-[2,3-13C2]neuraminic Acid

Sign In for Pricing
View Details
Nudifloramide
TRC-N925500-250MG 250 mg

Nudifloramide

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704719 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
p53 (TP53) (16-25) Mouse Monoclonal Antibody [Clone ID: X77]
AM05279PU-N 100 µg

p53 (TP53) (16-25) Mouse Monoclonal Antibody [Clone ID: X77]

Sign In for Pricing
View Details
FMOC-Glu (5/6-TAMRA) -OH
5014-AAT 100 mg

FMOC-Glu (5/6-TAMRA) -OH

Sign In for Pricing
View Details
Recombinant Human 2B4/CD244 Protein (His Tag)
PKSH032784-01 10 µg

Recombinant Human 2B4/CD244 Protein (His Tag)

Sign In for Pricing
View Details