Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter lari ATP synthase subunit c (atpE)

This Recombinant Campylobacter lari ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B9KD84

Expression Region

1-107

Origin

Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKIVFLMLALSGFAFAAEGSMNQWLASFSILAAGLGLGVAALGGAIGMGNTAAATIAGT ARNPGLGGKLMTTMFIALAMIEAQVIYALVIALIALYANPFQALVAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDHB Rabbit Polyclonal Antibody
TA369261 100 µL

PDHB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD209b Antibody[22D1]
E-AB-F10220-01 100 µg

AF/LE Purified Anti-Mouse CD209b Antibody[22D1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD209b Antibody[22D1]
E-AB-F10220-02 1 mg

AF/LE Purified Anti-Mouse CD209b Antibody[22D1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD209b Antibody[22D1]
E-AB-F10220-03 5 mg

AF/LE Purified Anti-Mouse CD209b Antibody[22D1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD209b Antibody[22D1]
E-AB-F10220-04 25 mg

AF/LE Purified Anti-Mouse CD209b Antibody[22D1]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD209b Antibody[22D1]
E-AB-F10220-05 50 mg

AF/LE Purified Anti-Mouse CD209b Antibody[22D1]

Sign In for Pricing
View Details