Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Protein 7a (7a)

This Recombinant Bat coronavirus HKU3 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3LZX7

Expression Region

16-122

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCSSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVYQELYSPLFLIVAALVFIILCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGI-1 Oligosaccharyltransferase (OST) inhibitor
TBI4291-50MG 50 mg

NGI-1 Oligosaccharyltransferase (OST) inhibitor

Sign In for Pricing
View Details
Slc25a22 3'UTR Lenti-reporter-Luc Vector
44004084 1.0 µg

Slc25a22 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
HIGD2A AAV Vector (Human) (CMV)
23286101 1 µg

HIGD2A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CNNM2 Protein Vector (Human) (pPM-C-HA)
PV070143 500 ng

CNNM2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GRP78 (78kD Glucose-regulated Protein)
482288 100 µL

GRP78 (78kD Glucose-regulated Protein)

Sign In for Pricing
View Details
Rabbit Anti-LEMD1/CT50 antibody
SL18215R-01 50 µL

Rabbit Anti-LEMD1/CT50 antibody

Sign In for Pricing
View Details