Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Protein 7a (7a)

This Recombinant Bat coronavirus HKU3 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3LZX7

Expression Region

16-122

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCSSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVYQELYSPLFLIVAALVFIILCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP44 Mouse Monoclonal Antibody [Clone ID: OTI1D1]
TA801913 100 µL

USP44 Mouse Monoclonal Antibody [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Heat shock 70 kDa protein C (hsp-3), partial
MBS1098937 Inquire

Recombinant Caenorhabditis elegans Heat shock 70 kDa protein C (hsp-3), partial

Sign In for Pricing
View Details
PGAP3 Antibody (Center) Blocking peptide
MBS9219774-01 0.5 mg

PGAP3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
PGAP3 Antibody (Center) Blocking peptide
MBS9219774-02 5x 0.5 mg

PGAP3 Antibody (Center) Blocking peptide

Sign In for Pricing
View Details
HIST2H2AC Polyclonal Antibody
A62742-020 20 µL

HIST2H2AC Polyclonal Antibody

Sign In for Pricing
View Details
Dnmt3a Rabbit Polyclonal Antibody (BF647)
orb1583113 100 µL

Dnmt3a Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details