Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Protein 7a (7a)

This Recombinant Bat coronavirus HKU3 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3LZX7

Expression Region

16-122

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCSSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVYQELYSPLFLIVAALVFIILCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr509 (NM_146372) Mouse Tagged Lenti ORF Clone
MR212630L3 10 µg

Olfr509 (NM_146372) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 750) discontinued
123557-ML750 100 µL

ARMET (Arginine-rich Mutated in Early Stage Tumors, Arginine-rich Protein, ARP, Mesencephalic Astrocyte-derived Neurotrophic Factor, MANF, MGC142148, MGC142150) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CACNA1C-AS3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV720388 1.0 µg DNA

CACNA1C-AS3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Half Fraser Broth (acc. to 11290) 4 x 3000 ml Bags
TMB_HFR_B3L_4 4 x 3000 mL Bags

Half Fraser Broth (acc. to 11290) 4 x 3000 ml Bags

Sign In for Pricing
View Details
BRCA2 (Breast Cancer Antigen, Early Onset Breast Ovarian Cancer Susceptibility Protein 2) (MaxLight 650) discontinued
B2708-10B-ML650 100 µL

BRCA2 (Breast Cancer Antigen, Early Onset Breast Ovarian Cancer Susceptibility Protein 2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
FSBP Antibody - C-terminal region
ARP32781_P050-25UL 25 µL

FSBP Antibody - C-terminal region

Sign In for Pricing
View Details