Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21 (21)

This Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21 (21) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF21

UniProt

Q64764

Expression Region

1-107

Origin

Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCTGSTGSLIPSVSDSANSVRRGNLSLCSVLLSWLICAMCLWNDARESLVNVRIANYVFD FAVLWTLLARVLGPPGRPVLQQHHPVQLPVPTEPSVFVKLCNQRVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-100 1x 100 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details