Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56)

This Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56) spans the amino acid sequence from region 2-108.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q9D2R6

Expression Region

2-108

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMTG LGIGALVLAIYGYTFYSVAQERFLDELEDEAKAARARALERERASGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL17P37 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV777075 1.0 µg DNA

RPL17P37 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D1]
CF503914 100 µg

Aminopeptidase A (ENPEP) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

Sign In for Pricing
View Details
TAF9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV659831 1.0 µg DNA

TAF9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant Mouse CXCL11 protein (N-His)(active)
MBS2569990-01 0.02 mg

Recombinant Mouse CXCL11 protein (N-His)(active)

Sign In for Pricing
View Details
Recombinant Mouse CXCL11 protein (N-His)(active)
MBS2569990-02 0.1 mg

Recombinant Mouse CXCL11 protein (N-His)(active)

Sign In for Pricing
View Details
Recombinant Mouse CXCL11 protein (N-His)(active)
MBS2569990-03 5x 0.1 mg

Recombinant Mouse CXCL11 protein (N-His)(active)

Sign In for Pricing
View Details