Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56)

This Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56) spans the amino acid sequence from region 2-108.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q9D2R6

Expression Region

2-108

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMTG LGIGALVLAIYGYTFYSVAQERFLDELEDEAKAARARALERERASGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human IgA - AcalephFluor750
CSA4134-01 100 µL

Mouse Anti-Human IgA - AcalephFluor750

Sign In for Pricing
View Details
Mouse Anti-Human IgA - AcalephFluor750
CSA4134-02 500 μL

Mouse Anti-Human IgA - AcalephFluor750

Sign In for Pricing
View Details
Mouse Anti-Human IgA - AcalephFluor750
CSA4134-03 1 mL

Mouse Anti-Human IgA - AcalephFluor750

Sign In for Pricing
View Details
Human METAP1 AssayLite™ Antibody (PerCP Conjugate)
32710-05171 5x 30 µg

Human METAP1 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Sodium hyaluronate
OR1044035-01 1 g

Sodium hyaluronate

Sign In for Pricing
View Details
Sodium hyaluronate
OR1044035-02 5 g

Sodium hyaluronate

Sign In for Pricing
View Details