Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56)

This Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56) spans the amino acid sequence from region 2-108.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q9D2R6

Expression Region

2-108

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAPGAGDPLNAKNGNAPFAQRIDPSREKLTPAQLQFMRQVQLAQWQKTLPQRRTRNIMTG LGIGALVLAIYGYTFYSVAQERFLDELEDEAKAARARALERERASGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERLEC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2767406 1.0 µg DNA

ERLEC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Reck Antibody - middle region
ARP59228_P050-25UL 25 µL

Reck Antibody - middle region

Sign In for Pricing
View Details
ADAP2 Protein Vector (Human) (pPM-C-His)
PV000740 500 ng

ADAP2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Insulin Like Growth Factor 1 (IGF1) Human ELISA Kit
E2830 96 Tests

Insulin Like Growth Factor 1 (IGF1) Human ELISA Kit

Sign In for Pricing
View Details
Rnf34 (NM_001004075) Rat Untagged Clone
RN201332 10 µg

Rnf34 (NM_001004075) Rat Untagged Clone

Sign In for Pricing
View Details
Mouse Ornithine Decarboxylase (ODC) ELISA Kit
orb1948653-01 48 Tests

Mouse Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details