Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Putative antitoxin VapB5 (vapB5)

This Recombinant Methanocaldococcus jannaschii Putative antitoxin VapB5 (vapB5) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Putative antitoxin VapB5

UniProt

P0CW39

Expression Region

1-107

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGPVIIPLISTLGLSFLAILLAYKISFSVIGFINSTLPTTLFPSKPYMLFVKISTISPL TCPSLIILTPALTWSLTALSMAYLYSSYKPNTFFTLSKNVSSFLTTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Marker (MTC754), CF568 conjugate, 0.1mg/mL
BNC680754-500 1x 500 µL

Mitochondrial Marker (MTC754), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS806094 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Mouse Epha6 activation kit by CRISPRa
GA201261 1 Kit

Mouse Epha6 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC20A2 Rabbit Polyclonal Antibody
TA381574 100 µL

SLC20A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCL25 Polyclonal Antibody
AN006870L-01 25 µL

CCL25 Polyclonal Antibody

Sign In for Pricing
View Details
CCL25 Polyclonal Antibody
AN006870L-02 100 µL

CCL25 Polyclonal Antibody

Sign In for Pricing
View Details