Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Putative antitoxin VapB5 (vapB5)

This Recombinant Methanocaldococcus jannaschii Putative antitoxin VapB5 (vapB5) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Putative antitoxin VapB5

UniProt

P0CW39

Expression Region

1-107

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGPVIIPLISTLGLSFLAILLAYKISFSVIGFINSTLPTTLFPSKPYMLFVKISTISPL TCPSLIILTPALTWSLTALSMAYLYSSYKPNTFFTLSKNVSSFLTTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL13P Human Gene Knockout Kit (CRISPR)
KN423458 1 Kit

TTLL13P Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-mTOR (S2448) Mouse Monoclonal Antibody [A5D5]
HA600094 100 µL

Phospho-mTOR (S2448) Mouse Monoclonal Antibody [A5D5]

Sign In for Pricing
View Details
SOX3 Rabbit Polyclonal Antibody
HA500388 100 µL

SOX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubr3 Mouse Gene Knockout Kit (CRISPR)
KN518621 1 Kit

Ubr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CX3CL1 Recombinant Rabbit monoclonal Antibody
HA723813 100 µL

Human CX3CL1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
EXT1 (NM_000127) Human Over-expression Lysate
LY424905 100 µg

EXT1 (NM_000127) Human Over-expression Lysate

Sign In for Pricing
View Details