Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A4FVW2

Expression Region

1-108

Origin

Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVKVCPEIQIAMDIDSGLIAEMRKDILVVDLHPVEDEINRLAQYAKALENSLDPRNSP MKAYAGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL
BNC880172-500 1x 500 µL

CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF740 conjugate, 0.1mg/mL
BNC742050-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details