Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A6UWH6

Expression Region

1-108

Origin

Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVKICPEIGIVMDVDTGIVAEMRKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAP LKAYDGRDNIYSVGGLFQSAFFGFWISLSILTLGLILVIGLYPKLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF594 conjugate, 0.1mg/mL
BNC941970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGAM4 (NM_001029891) Human Over-expression Lysate
LC422267 20 µg

PGAM4 (NM_001029891) Human Over-expression Lysate

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Human Gene Knockout Kit (CRISPR)
KN216630 1 Kit

DNA PKcs (PRKDC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM49D1 Human Gene Knockout Kit (CRISPR)
KN432770 1 Kit

TRIM49D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tff2 (NM_009363) Mouse Tagged ORF Clone
MG200716 10 µg

Tff2 (NM_009363) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit
RD-PLOD2-Hu-01 96 Tests

Human Procollagen Lysine-2-Oxoglutarate-5-Dioxygenase 2 (PLOD2) ELISA Kit

Sign In for Pricing
View Details