Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A6UWH6

Expression Region

1-108

Origin

Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVKICPEIGIVMDVDTGIVAEMRKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAP LKAYDGRDNIYSVGGLFQSAFFGFWISLSILTLGLILVIGLYPKLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diosmetin 3’,7-Diglucuronide (>85%)
TRC-D485040-1MG 1 mg

Diosmetin 3’,7-Diglucuronide (>85%)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-,  20nm
GP-1701-20 1 mL

Colloidal Gold Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-, 20nm

Sign In for Pricing
View Details
STAT5B (STAT5B/2611), 0.2mg/mL
BNUB2611-100 1x 100 µL

STAT5B (STAT5B/2611), 0.2mg/mL

Sign In for Pricing
View Details
PSG4 (NM_002780) Human Over-expression Lysate
LY419108 100 µg

PSG4 (NM_002780) Human Over-expression Lysate

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF647 conjugate, 0.1mg/mL
BNC472570-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZMYND17 (MSS51) activation kit by CRISPRa
GA114665 1 Kit

Human ZMYND17 (MSS51) activation kit by CRISPRa

Sign In for Pricing
View Details