Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus aeolicus Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A6UWH6

Expression Region

1-108

Origin

Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELVKICPEIGIVMDVDTGIVAEMRKDILVVDLNPIKEEINKLETLSKAFENSLDPRSAP LKAYDGRDNIYSVGGLFQSAFFGFWISLSILTLGLILVIGLYPKLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FST Antibody
KC-7260-01 50 μL

FST Antibody

Sign In for Pricing
View Details
FST Antibody
KC-7260-02 100 µL

FST Antibody

Sign In for Pricing
View Details
FST Antibody
KC-7260-03 1 mL

FST Antibody

Sign In for Pricing
View Details
Primer Panel
HPP6011D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details
Tylvalosin (>90%)
TRC-T898211-5MG 5 mg

Tylvalosin (>90%)

Sign In for Pricing
View Details
AKAP3 Antibody
8C10200-AAT 50 µg

AKAP3 Antibody

Sign In for Pricing
View Details