Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A6VHF1

Expression Region

1-108

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNSP MKAYNGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)
PDEH100790-01 20 µg

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)
PDEH100790-02 100 µg

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)
PDEH100790-03 500 µg

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)
PDEH100790-04 1 mg

Recombinant Human Collagen alpha-1 (I) chain/COL1A1 protein (TRX, His tag)

Sign In for Pricing
View Details
Human alpha 5 Defensin (DEFA5) activation kit by CRISPRa
GA101180 1 Kit

Human alpha 5 Defensin (DEFA5) activation kit by CRISPRa

Sign In for Pricing
View Details
PLGF (PLGF93), CF740 conjugate, 0.1mg/mL
BNC740093-100 1x 100 µL

PLGF (PLGF93), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details