Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

A6VHF1

Expression Region

1-108

Origin

Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNSP MKAYNGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iyd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25218116 3x 1.0 µg

Iyd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-Keap1 Antibody Picoband® (FITC Conjugate)
PB9762-FITC 100 µg/Vial

Anti-Keap1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Human SOD1 (Superoxide dismutase [Cu-Zn]) ELISA Kit
EH0649 96 Tests

Human SOD1 (Superoxide dismutase [Cu-Zn]) ELISA Kit

Sign In for Pricing
View Details
Fractalkine/CX3CL1 BioAssayTM ELISA Kit (Human)
143839 96 Tests

Fractalkine/CX3CL1 BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Neuraminidase (NEU1) (NM_000434) Human Tagged Lenti ORF Clone
RC200386L1 10 µg

Neuraminidase (NEU1) (NM_000434) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human KRT8 ELISA Kit (Ready to Use)
orb551291-01 48 Tests

Human KRT8 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details