Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yvlA (yvlA)

This Recombinant Bacillus subtilis Uncharacterized protein yvlA (yvlA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein yvlA

UniProt

O34322

Expression Region

1-108

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIA LLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2-Hydroxyethyl) Pseudoephedrine-d3
TRC-H825277-1MG 1 mg

N-(2-Hydroxyethyl) Pseudoephedrine-d3

Sign In for Pricing
View Details
IGJ Recombinant Rabbit Monoclonal Antibody [PD00-89]
HA721205 100 µL

IGJ Recombinant Rabbit Monoclonal Antibody [PD00-89]

Sign In for Pricing
View Details
PIK3R4 antibody
FNab09427 100 µg

PIK3R4 antibody

Sign In for Pricing
View Details
Prr5 Mouse Gene Knockout Kit (CRISPR)
KN514002 1 Kit

Prr5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Annexin A3 (ANXA3) activation kit by CRISPRa
GA100208 1 Kit

Human Annexin A3 (ANXA3) activation kit by CRISPRa

Sign In for Pricing
View Details
VPS4A Polyclonal Antibody
E-AB-66068-01 60 µL

VPS4A Polyclonal Antibody

Sign In for Pricing
View Details