Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein YLL014W

UniProt

Q12431

Expression Region

1-108

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLI NVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FBXO42 Antibody (OTI2G7) [Janelia Fluor 549]
NBP2-71958JF549 0.1 mL

Mouse Monoclonal FBXO42 Antibody (OTI2G7) [Janelia Fluor 549]

Sign In for Pricing
View Details
ELISA Kit For Interleukin-1 alpha
E0071p 96 Tests

ELISA Kit For Interleukin-1 alpha

Sign In for Pricing
View Details
SORL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2259307 1.0 µg DNA

SORL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Motilin
548743 200 µL

Motilin

Sign In for Pricing
View Details
Mgat4b (NM_001127533) Rat Tagged Lenti ORF Clone
RR208968L4 10 µg

Mgat4b (NM_001127533) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Anti-Human IgG1 (gamma1 chain)-FITC Conjugate Antibody
MBS4152387-01 0.1 mg

Mouse Anti-Human IgG1 (gamma1 chain)-FITC Conjugate Antibody

Sign In for Pricing
View Details