Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein YLL014W

UniProt

Q12431

Expression Region

1-108

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLI NVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-KIF11 (Thr926) Antibody Blocking Peptide
orb1501442 500 µg

Phospho-KIF11 (Thr926) Antibody Blocking Peptide

Sign In for Pricing
View Details
FA58A discontinued
536176-01 30ul

FA58A discontinued

Sign In for Pricing
View Details
FA58A discontinued
536176-02 100 µL

FA58A discontinued

Sign In for Pricing
View Details
Recombinant Mouse UPF0492 protein C20orf94 homolog
MBS1470622-01 0.02 mg (E-Coli)

Recombinant Mouse UPF0492 protein C20orf94 homolog

Sign In for Pricing
View Details
Recombinant Mouse UPF0492 protein C20orf94 homolog
MBS1470622-02 0.02 mg (Yeast)

Recombinant Mouse UPF0492 protein C20orf94 homolog

Sign In for Pricing
View Details
Recombinant Mouse UPF0492 protein C20orf94 homolog
MBS1470622-03 0.1 mg (E-Coli)

Recombinant Mouse UPF0492 protein C20orf94 homolog

Sign In for Pricing
View Details