Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YLL014W (EMC6) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein YLL014W

UniProt

Q12431

Expression Region

1-108

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLI NVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)
abx710178-01 100 mL

Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)

Sign In for Pricing
View Details
Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)
abx710178-02 500 mL

Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)

Sign In for Pricing
View Details
Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)
abx710178-03 1 L

Medium for Rabbit Esophageal Smooth Muscle Cells (ESMC)

Sign In for Pricing
View Details
CXCL14 CRISPRa sgRNA lentivector (set of three targets)(Human)
17170121 3x 1.0µg DNA

CXCL14 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CDV3, NT (Protein CDV3 homolog,CDV3,H41) (AP)
MBS6284809-01 0.2 mL

CDV3, NT (Protein CDV3 homolog,CDV3,H41) (AP)

Sign In for Pricing
View Details
CDV3, NT (Protein CDV3 homolog,CDV3,H41) (AP)
MBS6284809-02 5x 0.2 mL

CDV3, NT (Protein CDV3 homolog,CDV3,H41) (AP)

Sign In for Pricing
View Details