Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044 (BpOF4_21044)

This Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044 (BpOF4_21044) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein BpOF4_21044, ORFB

UniProt

Q45130

Expression Region

1-108

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEIFKELEGDCMGENVQLKDVIFNDSKYSKTKKVLAIMFITFVFLLQVNGTDKMIGFIF VFTGTVIGVTYSVCKLLFYNTKRYIKDIVFLIIFVCLFVWGIITFFNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Olfactory receptor 2AG1 (OR2AG1) ELISA kit
GTR10391965 96 Well

Porcine Olfactory receptor 2AG1 (OR2AG1) ELISA kit

Sign In for Pricing
View Details
Rabbit Monoclonal HGF Antibody (016) [Alexa Fluor 750]
NBP3-26881AF750 0.1 mL

Rabbit Monoclonal HGF Antibody (016) [Alexa Fluor 750]

Sign In for Pricing
View Details
Goose Lysolecithin ELISA Kit
MBS017199 Inquire

Goose Lysolecithin ELISA Kit

Sign In for Pricing
View Details
Human Papillomavirus Type 18 L1, HPV18L1 ELISA Kit
MBS1611968 96 Well

Human Papillomavirus Type 18 L1, HPV18L1 ELISA Kit

Sign In for Pricing
View Details
SCNN1a ELISA Kit (Rat) (OKDD00787)
OKDD00787 96 Well

SCNN1a ELISA Kit (Rat) (OKDD00787)

Sign In for Pricing
View Details
PTCD1 Human Over-expression Lysate
orb1377213 20 µg

PTCD1 Human Over-expression Lysate

Sign In for Pricing
View Details