Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044 (BpOF4_21044)

This Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044 (BpOF4_21044) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein BpOF4_21044, ORFB

UniProt

Q45130

Expression Region

1-108

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEIFKELEGDCMGENVQLKDVIFNDSKYSKTKKVLAIMFITFVFLLQVNGTDKMIGFIF VFTGTVIGVTYSVCKLLFYNTKRYIKDIVFLIIFVCLFVWGIITFFNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG3 Polyclonal Antibody, PerCP Conjugated
bs-13610R-PerCP 100 µL

HCG3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
CD163 (ABT-CD163) Mouse mAb
E2252704 100 µL

CD163 (ABT-CD163) Mouse mAb

Sign In for Pricing
View Details
Mouse Monoclonal EN-RAGE/S100A12 Antibody (OTI1D1) [Janelia Fluor 646]
NBP2-71276JF646 0.1 mL

Mouse Monoclonal EN-RAGE/S100A12 Antibody (OTI1D1) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mdfi (NM_001109973) Mouse Tagged Lenti ORF Clone
MR219428L3 10 µg

Mdfi (NM_001109973) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Monoclonal CCR4 Antibody (mogamulizumab) [Janelia Fluor 669]
NBP3-28547JF669 0.1 mL

Human Monoclonal CCR4 Antibody (mogamulizumab) [Janelia Fluor 669]

Sign In for Pricing
View Details
Influenza A (Nucleoprotein) (AP) discontinued
I7650-84-AP 100 µL

Influenza A (Nucleoprotein) (AP) discontinued

Sign In for Pricing
View Details