Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 1 (cbaA)

This Recombinant Cytochrome c oxidase subunit 1 (cbaA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 1, EC= 1.9.3.1, Cytochrome c ba (3) subunit I, Cytochrome c oxidase polypeptide I, Cytochrome cba3 subunit 1

UniProt

Q56408

Expression Region

1-108

Origin

Thermus thermophilus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IRALPWDNPAFVAPVLGLLGFIPGGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTL TAMGSLYWLLPNLTGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pithecia irrorata Progesterone receptor (PGR), partial
MBS1104313 Inquire

Recombinant Pithecia irrorata Progesterone receptor (PGR), partial

Sign In for Pricing
View Details
Candida albicans
D0021 100 Reactions

Candida albicans

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
MBS2033301-01 0.01 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
MBS2033301-02 0.05 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
MBS2033301-03 0.1 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details
Recombinant Follistatin Like Protein 1 (FSTL1)
MBS2033301-04 0.2 mg

Recombinant Follistatin Like Protein 1 (FSTL1)

Sign In for Pricing
View Details