Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adelaide River virus Protein alpha-1

This Recombinant Adelaide River virus Protein alpha-1 spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein alpha-1

UniProt

Q65107

Expression Region

1-108

Origin

Adelaide River virus (ARV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADHARLISLPSSVQDFFNQISSIFKSIENFYLLYKTRLKIFLICTIALIVIVLVAKIIK YTLAFHACIKIYCKPLIKTTNCLLKLGKRKRRKKKRKGKSIRLKELSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans har-1 Polyclonal Antibody
MBS7187378 Inquire

Rabbit anti-Caenorhabditis elegans har-1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit (vatP)
MBS1013373 Inquire

Recombinant Dictyostelium discoideum V-type proton ATPase proteolipid subunit (vatP)

Sign In for Pricing
View Details
Slc35e2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4558707 1.0 µg DNA

Slc35e2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
SNORD115-43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2245406 1.0 µg DNA

SNORD115-43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Research Grade Zubotamig
MBS1581621-01 0.1 mg

Research Grade Zubotamig

Sign In for Pricing
View Details
Research Grade Zubotamig
MBS1581621-02 1 mg

Research Grade Zubotamig

Sign In for Pricing
View Details