Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adelaide River virus Protein alpha-1

This Recombinant Adelaide River virus Protein alpha-1 spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein alpha-1

UniProt

Q65107

Expression Region

1-108

Origin

Adelaide River virus (ARV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADHARLISLPSSVQDFFNQISSIFKSIENFYLLYKTRLKIFLICTIALIVIVLVAKIIK YTLAFHACIKIYCKPLIKTTNCLLKLGKRKRRKKKRKGKSIRLKELSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SC23A rabbit pAb Antibody
orb2303911-01 50 µL

SC23A rabbit pAb Antibody

Sign In for Pricing
View Details
SC23A rabbit pAb Antibody
orb2303911-02 100 µL

SC23A rabbit pAb Antibody

Sign In for Pricing
View Details
GlycoElute Elution Buffer - VRA
21511320-3 50 mL

GlycoElute Elution Buffer - VRA

Sign In for Pricing
View Details
Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit
MBS026376-01 48 Well

Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit

Sign In for Pricing
View Details
Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit
MBS026376-02 96 Well

Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit

Sign In for Pricing
View Details
Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit
MBS026376-03 5x 96 Well

Hamster Adenylate Cyclase Activating Polypeptide 1, Pituitary ELISA Kit

Sign In for Pricing
View Details