Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

Q6LWZ1

Expression Region

1-108

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNTP MKAYAGREGTYKLAGMFQGMFFGFWVTMAVLVLVTILAVKMNLSLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-Tolidine Dihydrochloride
TRC-T733885-500MG 500 mg

O-Tolidine Dihydrochloride

Sign In for Pricing
View Details
SN-38-d3 Glucuronide
TRC-S589982-1MG 1 mg

SN-38-d3 Glucuronide

Sign In for Pricing
View Details
Eicosanedial
TRC-E332030-10MG 10 mg

Eicosanedial

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]
E-AB-F1216UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse H-2 Antibody[M1/42]

Sign In for Pricing
View Details
Neuraminidase (NEU1) Human Gene Knockout Kit (CRISPR)
KN200386BN 1 Kit

Neuraminidase (NEU1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details