Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

Q6LWZ1

Expression Region

1-108

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNTP MKAYAGREGTYKLAGMFQGMFFGFWVTMAVLVLVTILAVKMNLSLIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrtm3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3743304 1.0 µg DNA

Lrrtm3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
STF 632-DIA 200-B7541 AC Signs
251256 Card of 1 Pictogram(s)

STF 632-DIA 200-B7541 AC Signs

Sign In for Pricing
View Details
MUC17 Protein (N-His, Human)
P506273 100 µg

MUC17 Protein (N-His, Human)

Sign In for Pricing
View Details
Human HYAL2 shRNA Plasmid
abx955720-01 150 µg

Human HYAL2 shRNA Plasmid

Sign In for Pricing
View Details
Human HYAL2 shRNA Plasmid
abx955720-02 300 µg

Human HYAL2 shRNA Plasmid

Sign In for Pricing
View Details
Olaparib Impurity 49
RM-O121675-01 10 mg

Olaparib Impurity 49

Sign In for Pricing
View Details