Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein-export membrane protein SecG (secG)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein-export membrane protein SecG (secG) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein-export membrane protein SecG

UniProt

Q8K9G9

Expression Region

1-108

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLFFLIFLIFISFSLIFLILLQSGKGFNNTIHLNTSNNFNFFNSVGSGGFIKNIIGFFA GFFLIFSIILCNINDKKVNSDVFLEKNTQKKTINEKKEQKILNSELPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROD1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV812431 1.0 µg DNA

ROD1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rabbit Polyclonal Aromatase Antibody [Alexa Fluor 350]
NBP2-97337AF350 0.1 mL

Rabbit Polyclonal Aromatase Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Timeless Recombinant Rabbit Monoclonal Antibody [JE51-39]
ET7110-23 100 µL

Timeless Recombinant Rabbit Monoclonal Antibody [JE51-39]

Sign In for Pricing
View Details
SKA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2804407 1.0 µg DNA

SKA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CLTA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0469308 1.0 µg DNA

CLTA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human BZW1 shRNA Plasmid
abx956461-01 150 µg

Human BZW1 shRNA Plasmid

Sign In for Pricing
View Details