Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Uncharacterized protein RC0045 (RC0045)

This Recombinant Rickettsia conorii Uncharacterized protein RC0045 (RC0045) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Uncharacterized protein RC0045

UniProt

Q92JM2

Expression Region

1-108

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNCPLSLQIVNVSYIVNTNSCSWIAFNNSKYPIKTIKINIININILGKINHMVIFCDNNI VIILWKIMVVIISSIIHRTYIRRWISRRNNIRRKASHACKQPNNTTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleveland Open Cup Flash Point Tester BPTL-233
BPTL-233 1 Unit

Cleveland Open Cup Flash Point Tester BPTL-233

Sign In for Pricing
View Details
PDE6H (NM_006205) Human Recombinant Protein
TP310215L 1 mg

PDE6H (NM_006205) Human Recombinant Protein

Sign In for Pricing
View Details
YARS2 (NM_001040436) Human Over-expression Lysate
LC421754 20 µg

YARS2 (NM_001040436) Human Over-expression Lysate

Sign In for Pricing
View Details
Ankdd1b Mouse Gene Knockout Kit (CRISPR)
KN501250 1 Kit

Ankdd1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin E1 (CCNE1) (C-term) Rabbit Polyclonal Antibody
AP13251PU-N 400 µL

Cyclin E1 (CCNE1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TNF-a
Y123161 100 µL

Anti-TNF-a

Sign In for Pricing
View Details